Lưu ý: Bản dịch của mục này hiện đang được kiểm tra chất lượng, vì vậy một số nội dung tạm thời chỉ hiển thị bằng tiếng Anh.
Mục từ này chưa được dịch sang ngôn ngữ của bạn, vì vậy nội dung gốc được hiển thị bên dưới.
nidogen
nidogen
Danh từ
Nidogen is a highly specialized biochemical term used almost exclusively in histology and cell biology. It describes a specific glycoprotein that acts as a molecular bridge, ensuring the structural integrity of the basement membrane by linking different layers of the extracellular matrix.
As a technical term for a specific protein, it is treated as an uncountable mass noun. It refers to the substance itself rather than individual molecules, meaning it does not typically take a plural form in scientific literature.
Ý nghĩa
Từ liên quan
basement membranelaminincollagenperlecanproteinglycoproteinextracellular matrixadhesionbindingcelltissueepitheliumendotheliumbasal laminaproteolysisenzymeproteasemetalloproteinasecleavagedomainpeptideamino acidfoldingstructuresecretionsynthesisgeneexpressionmutationpathologywound healingangiogenesismigrationproliferationdifferentiationscaffoldanchorintegrinreceptorligandaffinitycomplexnetworkpolymerizationcrosslinkingsolubilitydiffusionpermeabilityfiltrationkidneyglomerulusblood vesselcapillaryskindermisepidermismorphogenesisembryodevelopmenthomeostasisbiochemistrymolecular biologyhistologycytologyphysiology