D
Dicread
হোমঅভিধানHholdfast

লক্ষ্য করুন: এই এন্ট্রির অনুবাদ বর্তমানে মান পর্যালোচনার অধীনে রয়েছে, তাই কিছু বিষয়বস্তু সাময়িকভাবে শুধুমাত্র ইংরেজিতে প্রদর্শিত হচ্ছে।

এই এন্ট্রিটি এখনও আপনার ভাষায় অনুবাদ করা হয়নি, তাই নিচে মূল লেখাটি দেখানো হচ্ছে।

holdfast

holdfast
Noun
pl: holdfasts

In biological contexts, this term describes a specialized anchoring organ. It is distinct from a true root because it does not absorb nutrients or water from the soil; its sole function is mechanical attachment to a hard surface, such as a rock or shell.

In mechanical engineering, the term refers to a clamping tool or fixture. It carries a connotation of absolute stability and rigidity, emphasizing the prevention of movement during high-pressure operations like drilling or milling.

Meanings

Nounholdfast

A biological structure, such as a root-like disc, used by seaweed or other algae to anchor themselves to a substrate.

The kelp uses a strong holdfast to remain attached to the rocky seabed during storms.

Nounholdfast

A mechanical device or a clamp used to secure a workpiece firmly in place during machining or construction.

The machinist tightened the holdfast to ensure the metal plate did not shift during drilling.

Examples

The kelp uses a strong holdfast to grip the rocky ocean floor.

none

The kelp uses a strong holdfast to grip the rocky ocean floor.

Make sure the holdfast is tightened before you start drilling.

Business

Make sure the holdfast is tightened before you start drilling.

I wonder if this holdfast can withstand the force of the tide.

none

I wonder if this holdfast can withstand the force of the tide.

The biologist examined the holdfast under a microscope to see how it adhered to the stone.

School Life

The biologist examined the holdfast under a microscope to see how it adhered to the stone.

Just clamp the holdfast onto the edge of the table.

none

Just clamp the holdfast onto the edge of the table.

Ancient marine fossils often show the imprint of a holdfast.

History

Ancient marine fossils often show the imprint of a holdfast.

We need a larger holdfast to secure this heavy steel plate.

Business

We need a larger holdfast to secure this heavy steel plate.

Look at how that seaweed holdfast has fused with the coral.

Travel

Look at how that seaweed holdfast has fused with the coral.

The workpiece shifted because the holdfast was not properly seated.

none

The workpiece shifted because the holdfast was not properly seated.

Related Words

anchorfasteningclampbracesupportattachmentdetachmentreleaseadhesiongripstabilityfixationrootrhizomeseaweedkelpalgaesubstraterockbedrockmarineoceantidecurrenttenacityfirmnesssecurityvicebracketboltscrewnailrivetwedgepegstakefoundationbasefootingstiffenertensioncompressionfrictionbondgluecementadhesivesuctionvacuumclaspgraspclutchholdsteadyimmobilestaticrigidfixedsecurefastenmoortether
সর্বশেষ আপডেট: May 2026একটি ত্রুটি রিপোর্ট করুন